FMOD Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2106390
Artikelname: FMOD Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2106390
Hersteller Artikelnummer: orb2106390
Alternativnummer: BYT-ORB2106390-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FMOD
Konjugation: FITC
Alternative Synonym: FM, SLRR2E
FMOD Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 43kDa
NCBI: 002014
UniProt: Q06828
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VYFQNNQITSIQEGVFDNATGLLWIALHGNQITSDKVGRKVFSKLRHLER