FLII Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2106392
Artikelname: FLII Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2106392
Hersteller Artikelnummer: orb2106392
Alternativnummer: BYT-ORB2106392-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FLII
Konjugation: HRP
Alternative Synonym: FLI, FLIL, Fli1
FLII Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 145kDa
NCBI: 002009
UniProt: Q13045
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: LAEDILNTMFDTSYSKQVINEGEEPENFFWVGIGAQKPYDDDAEYMKHTR