ARAF Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2106423
Artikelname: ARAF Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2106423
Hersteller Artikelnummer: orb2106423
Alternativnummer: BYT-ORB2106423-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARAF
Konjugation: FITC
Alternative Synonym: PKS2, A-RAF, ARAF1, RAFA1
ARAF Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 67kDa
NCBI: 001645
UniProt: P10398
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: PRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGYRDSGYYW