IFRD1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2106433
Artikelname: IFRD1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2106433
Hersteller Artikelnummer: orb2106433
Alternativnummer: BYT-ORB2106433-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IFRD1
Konjugation: Biotin
Alternative Synonym: PC4, TIS7
IFRD1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 50kDa
NCBI: 001541
UniProt: O00458
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LALLFELARGIESDFFYEDMESLTQMLRALATDGNKHRAKVDKRKQRSVF