Dnaja1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2106441
Artikelname: Dnaja1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2106441
Hersteller Artikelnummer: orb2106441
Alternativnummer: BYT-ORB2106441-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
Konjugation: FITC
Alternative Synonym: Hsj, Hsj2, Nedd, HSJ-2, Nedd7
Dnaja1 Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 44kDa
NCBI: 032324
UniProt: P63037
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: YDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLAD