ACADVL Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2106593
Artikelname: ACADVL Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2106593
Hersteller Artikelnummer: orb2106593
Alternativnummer: BYT-ORB2106593-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ACADVL
Konjugation: HRP
Alternative Synonym: ACAD6, LCACD, VLCAD
ACADVL Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 64kDa
NCBI: 001029031
UniProt: P49748
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: IDLYAMVVVLSRASRSLSEGHPTAQHEKMLCDTWCIEAAARIREGMAALQ