HMBS Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2106659
Artikelname: HMBS Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2106659
Hersteller Artikelnummer: orb2106659
Alternativnummer: BYT-ORB2106659-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HMBS
Konjugation: HRP
Alternative Synonym: UPS, PBGD, PORC, PBG-D
HMBS Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 38kDa
NCBI: 001019553
UniProt: P08397
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: MRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTGDKILDTA