TXLNG Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2106760
Artikelname: TXLNG Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2106760
Hersteller Artikelnummer: orb2106760
Alternativnummer: BYT-ORB2106760-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human TXLNG
Konjugation: Biotin
Alternative Synonym: ELRG, FIAT, LSR5, TXLNGX, CXorf15
TXLNG Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 58kDa
NCBI: 060830
UniProt: Q9NUQ3
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KADMLCNSQSNDILQHQGSNCGGTSNKHSLEEDEGSDFITENRNLVSPAY