FNDC11 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2107198
Artikelname: FNDC11 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2107198
Hersteller Artikelnummer: orb2107198
Alternativnummer: BYT-ORB2107198-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C20orf195
Konjugation: Biotin
Alternative Synonym: C20orf195
FNDC11 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 076964
UniProt: Q9BVV2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: RMKKVGTAQTKIQLLLLGDLLEQLDHGRAELDALLRSPDPRPFLADWALV