SPATA6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2107246
Artikelname: SPATA6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2107246
Hersteller Artikelnummer: orb2107246
Alternativnummer: BYT-ORB2107246-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SPATA6
Konjugation: Biotin
Alternative Synonym: HASH, SRF1, SRF-1
SPATA6 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 54kDa
NCBI: 061946
UniProt: Q9NWH7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SQKKKSKSPERSKYCINAKNYEQPTISSKSHSPSPYTKRRMCELSEDTRR