Actl7a Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2107381
Artikelname: Actl7a Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2107381
Hersteller Artikelnummer: orb2107381
Alternativnummer: BYT-ORB2107381-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Mouse Actl7a
Konjugation: Biotin
Alternative Synonym: Tact, Tact2
Actl7a Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 48kDa
NCBI: 033741
UniProt: Q9QY84
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VVPIYEGYPLPSITGRLDYAGSDLTTYLMNLMNNSGKHFSEDHLGIVEDI