RANBP9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2107435
Artikelname: RANBP9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2107435
Hersteller Artikelnummer: orb2107435
Alternativnummer: BYT-ORB2107435-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen for Anti-RANBP9 antibody is: synthetic peptide directed towards the Middle region of Human RANB9
Konjugation: Biotin
Alternative Synonym: BPM-L, BPM90, RANBPM, RanBP7
RANBP9 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 42 kDa
UniProt: Q96S59
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: FTLKVRQFIEMVNGTDSEVRCLGGRSPKSQDSYPVSPRPFSSPSMSPSHG