PLA2G4E Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2107600
| Artikelname: |
PLA2G4E Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2107600 |
| Hersteller Artikelnummer: |
orb2107600 |
| Alternativnummer: |
BYT-ORB2107600-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the c terminal region of human PLA2G4E |
| Konjugation: |
Biotin |
| Alternative Synonym: |
FLJ45651, MGC126633, MGC126661 |
| PLA2G4E Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
96kDa |
| NCBI: |
001073959 |
| UniProt: |
C9JK77 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: TFFPLINDTFRKYKAPGVERSPEELEQGQVDIYGPKTPYATKELTYTEAT |
