Cst6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2107618
Artikelname: Cst6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2107618
Hersteller Artikelnummer: orb2107618
Alternativnummer: BYT-ORB2107618-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human Cst6
Konjugation: Biotin
Alternative Synonym: ichq, N28197, 1110017E11Rik
Cst6 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 16kDa
NCBI: 082899
UniProt: Q9D1B1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: CGELIPPPPPSYRLSLTLTSPLSTAAKELVLIPLHAAPNQAVAEIDALYD