C1orf102 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2107651
Artikelname: C1orf102 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2107651
Hersteller Artikelnummer: orb2107651
Alternativnummer: BYT-ORB2107651-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C1orf102
Konjugation: Biotin
Alternative Synonym: NOR1, C1orf102
C1orf102 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 26kDa
NCBI: 996668
UniProt: A6NIN9
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: ARKVLNDIISTMFNRKFMEELFKPQELYSKKALRTVYERLAHASIMKLNQ