THAP5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2107771
Artikelname: THAP5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2107771
Hersteller Artikelnummer: orb2107771
Alternativnummer: BYT-ORB2107771-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human THAP5
Konjugation: Biotin
THAP5 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 44kDa
NCBI: 001123947
UniProt: Q7Z6K1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: TTITLTTSNSESIHQSLETQEVLEVTTSHLANPNFTSNSMEIKSAQENPF