DEUP1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2107812
Artikelname: DEUP1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2107812
Hersteller Artikelnummer: orb2107812
Alternativnummer: BYT-ORB2107812-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human CCDC67
Konjugation: FITC
Alternative Synonym: CCDC67
DEUP1 Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 38kDa
NCBI: 857596
UniProt: Q05D60
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: HQMKQNKVPRKELPHLKEEIPFELSNLNQKLEEFRAKSREWDKQEILYQT