KLC3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2107891
Artikelname: KLC3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2107891
Hersteller Artikelnummer: orb2107891
Alternativnummer: BYT-ORB2107891-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KLC3
Konjugation: Biotin
Alternative Synonym: KLC2, KLCt, KLC2L, KNS2B
KLC3 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 55kDa
NCBI: 803136
UniProt: Q6P597
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LLCQNQGKFEDVERHYARALSIYEALGGPHDPNVAKTKNNLASAYLKQNK