CHMP4B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2107903
Artikelname: CHMP4B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2107903
Hersteller Artikelnummer: orb2107903
Alternativnummer: BYT-ORB2107903-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CHMP4B
Konjugation: Biotin
Alternative Synonym: SNF7, CTPP3, Shax1, CHMP4A, SNF7-2, VPS32B, CTRCT31, Vps32-2, C20orf178, dJ553F4.4
CHMP4B Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 25kDa
NCBI: 789782
UniProt: Q9H444
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: EEISTAISKPVGFGEEFDEDELMAELEELEQEELDKNLLEISGPETVPLP