ZCCHC12 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2107987
Artikelname: ZCCHC12 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2107987
Hersteller Artikelnummer: orb2107987
Alternativnummer: BYT-ORB2107987-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZCCHC12
Konjugation: Biotin
Alternative Synonym: SIZN, SIZN1, PNMA7A
ZCCHC12 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 45kDa
NCBI: 776159
UniProt: Q6PEW1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: AREVMRVLQATNPNLSVADFLRAMKLVFGESESSVTAHGKFFNTLQAQGE