SLC25A48 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2108644
Artikelname: SLC25A48 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2108644
Hersteller Artikelnummer: orb2108644
Alternativnummer: BYT-ORB2108644-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the c terminal region of human LOC153328
Konjugation: Biotin
Alternative Synonym: HDMCP
SLC25A48 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 31kDa
NCBI: 86705
UniProt: Q6ZT89
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: TAVGQLGNCHALLSPGGGQDTFRYSPNNSLLGTYSVPGPLPPQSHPFPMQ