C1orf96 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2108665
Artikelname: C1orf96 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2108665
Hersteller Artikelnummer: orb2108665
Alternativnummer: BYT-ORB2108665-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C1orf96
Konjugation: Biotin
Alternative Synonym: CSAP, C1orf96
C1orf96 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 30
NCBI: 660300
UniProt: Q6IQ19
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: ENKHPFALYGWGEKQTDTGSQKTHNVCASAPVHEIHESALRAKNRRQVEK