SPATA5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2108689
Artikelname: SPATA5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2108689
Hersteller Artikelnummer: orb2108689
Alternativnummer: BYT-ORB2108689-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Immunogen: The immunogen is a synthetic peptide directed towards the following sequence EIIELPLKQPELFKSYGIPAPRGVLLYGPPGTGKTMIARAVANEVGAYVS
Konjugation: Biotin
Alternative Synonym: AFG2, SPAF, EHLMRS
SPATA5 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 98 kDa
NCBI: 660208
UniProt: Q8NB90
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: EIIELPLKQPELFKSYGIPAPRGVLLYGPPGTGKTMIARAVANEVGAYVS