DIRAS1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2108704
Artikelname: DIRAS1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2108704
Hersteller Artikelnummer: orb2108704
Alternativnummer: BYT-ORB2108704-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DIRAS1
Konjugation: Biotin
Alternative Synonym: RIG, GBTS1, Di-Ras1
DIRAS1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 22kDa
NCBI: 660156
UniProt: O95057
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVK