FAM82A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2108797
Artikelname: FAM82A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2108797
Hersteller Artikelnummer: orb2108797
Alternativnummer: BYT-ORB2108797-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FAM82A
Konjugation: Biotin
Alternative Synonym: RMD2, RMD4, RMD-2, FAM82A, BLOCK18, FAM82A1, PRO34163, PYST9371
FAM82A Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 65kDa
NCBI: 653314
UniProt: Q96LZ7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: WRFARAYGDMYELSTNTQEKKHYANIGKTLSERAINRAPMNGHCHLWYAV