TEKT4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2108800
Artikelname: TEKT4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2108800
Hersteller Artikelnummer: orb2108800
Alternativnummer: BYT-ORB2108800-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TEKT4
Konjugation: Biotin
Alternative Synonym: MGC27019
TEKT4 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 51kDa
NCBI: 653306
UniProt: Q8WW24
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LATETQALAQRTQQDSTRTVGERLQDTHSWKSELQREMEALAAETNLLLA