LSM14B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2108809
Artikelname: LSM14B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2108809
Hersteller Artikelnummer: orb2108809
Alternativnummer: BYT-ORB2108809-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of HUMAN LSM14B
Konjugation: Biotin
Alternative Synonym: FT005, LSM13, FAM61B, RAP55B, C20orf40, bA11M20.3
LSM14B Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 26kDa
UniProt: Q9BX40
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: GPLAASSLLSQQYAASLGLEKLVSPPASAAASSPSSSPSPQPVSELDLSS