PHETA1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2108824
Artikelname: PHETA1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2108824
Hersteller Artikelnummer: orb2108824
Alternativnummer: BYT-ORB2108824-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAM109A
Konjugation: Biotin
Alternative Synonym: SES1, FAM109A, IPIP27A
PHETA1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 27kDa
NCBI: 653272
UniProt: Q8N4B1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: HRRWFVLRGNMLFYFEDAASREPVGVIILEGCTVELVEAAEEFAFAVRFA