Capsl Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2108848
Artikelname: Capsl Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2108848
Hersteller Artikelnummer: orb2108848
Alternativnummer: BYT-ORB2108848-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat
Konjugation: Biotin
Alternative Synonym: RGD1308776
Capsl Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 24kDa
NCBI: 001099887
UniProt: D4A6W9
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: HHPKYQNGEWTEEQVFRKFLDNFDSPYDKDGLVTPEEFMNYYAGVSASID