IQCD Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2109023
Artikelname: IQCD Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2109023
Hersteller Artikelnummer: orb2109023
Alternativnummer: BYT-ORB2109023-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IQCD
Konjugation: HRP
Alternative Synonym: DRC10, CFAP84, 4933433C09Rik
IQCD Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 40
NCBI: 612460
UniProt: Q96DY2
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: CLKEKERQLQEQKEAEEEGWLRDRLLSIELQKSSLSPLMQQIKDSTKNVL