CGAS Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2109032
Artikelname: CGAS Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2109032
Hersteller Artikelnummer: orb2109032
Alternativnummer: BYT-ORB2109032-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C6orf150
Konjugation: HRP
Alternative Synonym: MB21D1, h-cGAS, C6orf150
CGAS Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 59kDa
NCBI: 612450
UniProt: Q8N884
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: VPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDC