GPRASP2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2109037
Artikelname: GPRASP2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2109037
Hersteller Artikelnummer: orb2109037
Alternativnummer: BYT-ORB2109037-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen for Anti-GPRASP2 antibody is: synthetic peptide directed towards the C-terminal region of Human GASP2
Konjugation: Biotin
Alternative Synonym: bHLHb9, p60TRP, ARMCX5-GPRASP2-BHLHB9-LINC00630
GPRASP2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 92 kDa
NCBI: 612446
UniProt: Q96D09
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: IHEISKIAMGMRSASQFTRDFIRDSGVVSLIETLLNYPSSRVRTSFLENM