GPRASP2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2109040
Artikelname: GPRASP2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2109040
Hersteller Artikelnummer: orb2109040
Alternativnummer: BYT-ORB2109040-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GPRASP2
Konjugation: Biotin
Alternative Synonym: DFNX7, GASP2
GPRASP2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 94kDa
NCBI: 612446
UniProt: Q96D09
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: EQESLLQPDQPSPEFTFQYDPSYRSVREIREHLRARESAESESWSCSCIQ