FAM83F Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2109043
Artikelname: FAM83F Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2109043
Hersteller Artikelnummer: orb2109043
Alternativnummer: BYT-ORB2109043-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FAM83F
Konjugation: Biotin
FAM83F Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 55kDa
NCBI: 612444
UniProt: Q8NEG4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: FRELYAISEEVDLYRQLSLAGRVGLHYSSTVARKLINPKYALVSGCRHPP