FAM83F Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2109045
Artikelname: FAM83F Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2109045
Hersteller Artikelnummer: orb2109045
Alternativnummer: BYT-ORB2109045-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAM83F
Konjugation: FITC
FAM83F Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 55
NCBI: 612444
UniProt: Q8NEG4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KDEKAPHLKQVVRQMIQQAQKVIAVVMDLFTDGDIFQDIVDAACKRRVPV