TRIB1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer:
BYT-ORB2109323
| Artikelname: |
TRIB1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2109323 |
| Hersteller Artikelnummer: |
orb2109323 |
| Alternativnummer: |
BYT-ORB2109323-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human TRIB1 |
| Konjugation: |
HRP |
| Alternative Synonym: |
C8FW, GIG2, TRB1, GIG-2, SKIP1, TRB-1 |
| TRIB1 Rabbit Polyclonal Antibody (HRP) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
41kDa |
| NCBI: |
079471 |
| UniProt: |
Q96RU8 |
| Puffer: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Formulierung: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Sequenz: |
Synthetic peptide located within the following region: REPSERLTAPEILLHPWFESVLEPGYIDSEIGTSDQIVPEYQEDSDISSF |
