CFHR3 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2109356
Artikelname: CFHR3 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2109356
Hersteller Artikelnummer: orb2109356
Alternativnummer: BYT-ORB2109356-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human FHR3
Konjugation: HRP
Alternative Synonym: FHR3, HLF4, CFHL3, FHR-3, DOWN16
CFHR3 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 36kDa
NCBI: 066303
UniProt: Q02985
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: FISESSSIYILNKEIQYKCKPGYATADGNSSGSITCLQNGWSAQPICINS