CRYGC Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2109365
Artikelname: CRYGC Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2109365
Hersteller Artikelnummer: orb2109365
Alternativnummer: BYT-ORB2109365-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CRYGC
Konjugation: HRP
Alternative Synonym: CCL, CRYG3, CTRCT2
CRYGC Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 21kDa
NCBI: 066269
UniProt: P07315
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: GLSDSIRSCCLIPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSE