CENTG1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2109406
Artikelname: CENTG1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2109406
Hersteller Artikelnummer: orb2109406
Alternativnummer: BYT-ORB2109406-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CENTG1
Konjugation: Biotin
Alternative Synonym: PIKE, GGAP2, CENTG1
CENTG1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 90kDa
NCBI: 055585
UniProt: Q99490
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: AHARHGPLDTSVEDPQLRSPLHLAAELAHVVITQLLLWYGADVAARDAQG