PRDX3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2109418
| Artikelname: |
PRDX3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2109418 |
| Hersteller Artikelnummer: |
orb2109418 |
| Alternativnummer: |
BYT-ORB2109418-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human PRDX3 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
AOP1, MER5, AOP-1, SP-22, HBC189, PRO1748, prx-III |
| PRDX3 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
26kDa |
| NCBI: |
054817 |
| UniProt: |
P30048 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: AIPWGISATAALRPAACGRTSLTNLLCSGSSQAPYFKGTAVVNGEFKDLS |
