RAB35 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2109553
Artikelname: RAB35 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2109553
Hersteller Artikelnummer: orb2109553
Alternativnummer: BYT-ORB2109553-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAB35
Konjugation: Biotin
Alternative Synonym: RAY, H-ray, RAB1C
RAB35 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 23kDa
NCBI: 006852
UniProt: Q15286
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: GIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTK