TOMM34 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2109568
Artikelname: TOMM34 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2109568
Hersteller Artikelnummer: orb2109568
Alternativnummer: BYT-ORB2109568-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TOMM34
Konjugation: Biotin
Alternative Synonym: TOM34, URCC3, HTOM34P
TOMM34 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 006800
UniProt: Q15785
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: ALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDCIKDCTSALALVPFS