CPLX2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2109616
| Artikelname: |
CPLX2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2109616 |
| Hersteller Artikelnummer: |
orb2109616 |
| Alternativnummer: |
BYT-ORB2109616-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human CPLX2 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
CPX2, Hfb1, 921-L, CPX-2 |
| CPLX2 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
15 |
| NCBI: |
006641 |
| UniProt: |
Q6PUV4 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKA |
