HBS1L Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2109646
Artikelname: HBS1L Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2109646
Hersteller Artikelnummer: orb2109646
Alternativnummer: BYT-ORB2109646-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HBS1L
Konjugation: Biotin
Alternative Synonym: ERFS, HBS1, EF-1a, eRF3c, HSPC276
HBS1L Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 22kDa
NCBI: 47980
UniProt: Q9Y450
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MNHKILVCFADQGSGFCITGKIEAGYIQTGDRLLAMPPNETCTVKGITLH