ANP32B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2109709
Artikelname: ANP32B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2109709
Hersteller Artikelnummer: orb2109709
Alternativnummer: BYT-ORB2109709-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ANP32B
Konjugation: Biotin
Alternative Synonym: APRIL, SSP29, PHAPI2
ANP32B Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 29kDa
NCBI: 006392
UniProt: Q92688
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: GLTAEFVNLEFLSLINVGLISVSNLPKLPKLKKLELSENRIFGGLDMLAE