HAX1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2109751
Artikelname: HAX1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2109751
Hersteller Artikelnummer: orb2109751
Alternativnummer: BYT-ORB2109751-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HAX1
Konjugation: Biotin
Alternative Synonym: SCN3, HS1BP1, HCLSBP1
HAX1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 31kDa
NCBI: 006109
UniProt: O00165
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LPGPESETPGERLREGQTLRDSMLKYPDSHQPRIFGGVLESDARSESPQP