PDIA6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2109823
Artikelname: PDIA6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2109823
Hersteller Artikelnummer: orb2109823
Alternativnummer: BYT-ORB2109823-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, IP, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PDIA6
Konjugation: Biotin
Alternative Synonym: P5, ERP5, TXNDC7
PDIA6 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 48kDa
NCBI: 005733
UniProt: Q922R8
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSS