CTDSP2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2109835
Artikelname: CTDSP2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2109835
Hersteller Artikelnummer: orb2109835
Alternativnummer: BYT-ORB2109835-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CTDSP2
Konjugation: Biotin
Alternative Synonym: OS4, PSR2, SCP2
CTDSP2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 31kDa
NCBI: 005721
UniProt: O14595
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: ASYIFHPENAVPVQSWFDDMADTELLNLIPIFEELSGAEDVYTSLGQLRA