CRYBA1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2109898
Artikelname: CRYBA1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2109898
Hersteller Artikelnummer: orb2109898
Alternativnummer: BYT-ORB2109898-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CRYBA1
Konjugation: Biotin
Alternative Synonym: CRYB1, CTRCT10
CRYBA1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 25kDa
NCBI: 005199
UniProt: P05813
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: METQAEQQELETLPTTKMAQTNPTPGSLGPWKITIYDQENFQGKRMEFTS