Ela1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2109976
| Artikelname: |
Ela1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2109976 |
| Hersteller Artikelnummer: |
orb2109976 |
| Alternativnummer: |
BYT-ORB2109976-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Konjugation: |
Biotin |
| Alternative Synonym: |
El, Ela, Ela1, PC-T, Ela-1, PC-TsF, 1810009A17Rik, 1810062B19Rik |
| Ela1 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
29kDa |
| NCBI: |
291090 |
| UniProt: |
Q91X79 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: RVVVGEHNLSQNDGTEQYVNVQKIVSHPYWNKNNVVAGYDIALLRLAKSV |
